Recombinant Human TROP-2/TACSTD2 Protein
Product Sizes
10 ul
£115.00
RP01048-10UL
20 ug
£145.00
RP01048-20UG
50 ul
£193.00
RP01048-50UL
100 ul
£276.00
RP01048-100UL
About this Product
- SKU:
- RP01048
- Additional Names:
- TACSTD2,EGP-1,EGP1,GA733-1,GA7331,GP50,M1S1,TROP2
- Extra Details:
- Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr88-Thr274) of human TROP-2 (Accession #NP_002344.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris,150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Thr88-Thr274
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- TLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01048
