Recombinant Human Galectin-9/LGALS9 Protein
Product Sizes
10 ug
£145.00
RP01046-10UG
About this Product
- SKU:
- RP01046
- Additional Names:
- LGALS9,HUAT,LGALS9A
- Extra Details:
- Recombinant Human Galectin-9/LGALS9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Thr323) of human Galectin-9/LGALS9 (Accession #NP_002299.2) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM MOPS,150mM NaCl,1mM EDTA,1mM DTT pH 7.4.
- Immunogen:
- Ala2-Thr323
- Molecular Weight:
- 36.59 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01046
