Recombinant Human Galectin-9/LGALS9 Protein
Product Sizes
10 ug
£145.00
RP01046-10UG
50 ug
£288.00
RP01046-50UG
500 ug
£1240.00
RP01046-500UG
1000 ug
£1954.00
RP01046-1000UG
About this Product
- SKU:
- RP01046
- Additional Names:
- LGALS9,HUAT,LGALS9A
- Extra Details:
- Recombinant Human Galectin-9/LGALS9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Thr323) of human Galectin-9/LGALS9 (Accession #NP_002299.2) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Recombinant Human Galectin-9/LGALS9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Thr323) of human Galectin-9/LGALS9 (Accession #NP_002299.
- Immunogen:
- Ala2-Thr323
- Molecular Weight:
- 50-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01046
