Recombinant Human FGF-2/bFGF Protein
Product Sizes
20 ug
£107.00
RP01042-20UG
50 ug
£145.00
RP01042-50UG
100 ug
£205.00
RP01042-100UG
500 ug
£526.00
RP01042-500UG
1000 ug
£812.00
RP01042-1000UG
About this Product
- SKU:
- RP01042
- Additional Names:
- BFGF, FGF-2, FGFB, HBGF-2,FGF2,FGF-2,FGFB,HBGF-2,Basic FGF, BFGF, fibroblast growth factor 2
- Extra Details:
- This protein is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.
- Formulation:
- Recombinant Human FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro143-Ser288) of human FGF2 (Accession #NP_001997.5).
- Immunogen:
- Pro143-Ser288
- Molecular Weight:
- 17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01042
