Recombinant Human IL-7 Protein
Product Sizes
10 ug
£163.00
RP01040-10UG
20 ug
£223.00
RP01040-20UG
50 ug
£336.00
RP01040-50UG
100 ug
£508.00
RP01040-100UG
500 ug
£1716.00
RP01040-500UG
1000 ug
£2716.00
RP01040-1000UG
About this Product
- SKU:
- RP01040
- Additional Names:
- IL7,IL-7
- Extra Details:
- Active Recombinant Human IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-His177) of human IL-7 (Accession #NP_000871.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Active Recombinant Human IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-His177) of human IL-7 (Accession #NP_000871.1) fused with a 6x
- Immunogen:
- Asp26-His177
- Molecular Weight:
- 30-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01040
