Recombinant Human IL-1R1/CD121a Protein
Product Sizes
10 ug
£133.00
RP01036-10UG
20 ug
£181.00
RP01036-20UG
50 ug
£240.00
RP01036-50UG
100 ug
£353.00
RP01036-100UG
About this Product
- SKU:
- RP01036
- Additional Names:
- IL1R1,CD121A,D2S1473,IL-1R-alpha,IL1R,IL1RA,P80
- Extra Details:
- Recombinant Human IL-1R1/CD121a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp21-Thr332) of human IL1R1 (Accession #NP_000868.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asp21-Thr332
- Molecular Weight:
- 36.70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01036










