Recombinant Human Cystatin-D/CST5 Protein

Product Sizes

10 ug

£193.00

RP01035-10UG

20 ug

£258.00

RP01035-20UG

50 ug

£383.00

RP01035-50UG

100 ug

£586.00

RP01035-100UG

500 ug

£1716.00

RP01035-500UG

1000 ug

£2716.00

RP01035-1000UG

About this Product

SKU:: RP01035
Additional Names:: CST5,MGC71922,CST5
Extra Details:: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Cystatins are natural inhibitors of papain-like (family C1) and legumain-related (family C13) cysteine peptidases. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. As a member of type 2 cystatin, cystatin D is a single-domain protein and also has cysteine residues that form disulfide bridges. The functions of Cystatin D are largely unknown. However, Cystatin D has been shown to inhibit coronavirus replication at its physiological concentration (0.12_x005f
Formulation:: Recombinant Human Cystatin-D/CST5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Val142) of human Cystatin D (Accession #NP_001891.2) fused
Immunogen:: Gly21-Val142
Molecular Weight:: 15-25 kDa
Physical State:: Lyophilized
Purity:: ≥90%
Sequence:: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket