Recombinant Human IL-2RG/CD132 Protein
Product Sizes
10 ug
£133.00
RP01031-10UG
20 ug
£181.00
RP01031-20UG
50 ug
£240.00
RP01031-50UG
100 ug
£353.00
RP01031-100UG
500 ug
£1002.00
RP01031-500UG
1000 ug
£1574.00
RP01031-1000UG
About this Product
- SKU:
- RP01031
- Additional Names:
- IL2RG,CD132,CIDX,IL-2RG,IMD4,P64,SCIDX,SCIDX1
- Extra Details:
- The gamma chain of the high affinity functional human IL-2 receptor complex belongs to the hematopoietin receptor family. The common gamma chain (G Gammac) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. IL2RG is a 369 amino acid residue protein consisting of a 22 residue signal sequence, a 232 residue extracellular domain, a 29 residue transmembrane domain and an 86 residue cytoplasmic domain. IL2RG is a cytokine receptor sub-unit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin-21 receptor. It has been proposed that IL2RG be designated the common gamma chain ( gamma c). The site of molecular defects in X-linked SCID (severe combined immunodeficiency) has now been mapped to the IL-2 R gamma gene.
- Formulation:
- Recombinant Human IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of human CD132 (Accession #NP_000197.1) fused with an
- Immunogen:
- Leu23-Asn254
- Molecular Weight:
- 90-100 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01031
