Recombinant Human EGF Protein
Product Sizes
50 ug
£127.00
RP01030-50UG
100 ug
£163.00
RP01030-100UG
About this Product
- SKU:
- RP01030
- Additional Names:
- EGF,HOMG4,URG
- Extra Details:
- Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with hFc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asn971-Arg1023
- Molecular Weight:
- 33.01 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01030








