Recombinant Human EGF Protein
Product Sizes
50 ug
£127.00
RP01030-50UG
100 ug
£163.00
RP01030-100UG
500 ug
£431.00
RP01030-500UG
1000 ug
£622.00
RP01030-1000UG
About this Product
- SKU:
- RP01030
- Additional Names:
- EGF,HOMG4,URG
- Extra Details:
- Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x005f
- Formulation:
- Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with hFc, 6xHi
- Immunogen:
- Asn971-Arg1023
- Molecular Weight:
- 40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01030
