Recombinant Human Angiopoietin-like 3/ANGPTL3(17-220) Protein

Product Sizes

20 ug

£157.00

RP01024-20UG

50 ug

£223.00

RP01024-50UG

100 ug

£336.00

RP01024-100UG

About this Product

SKU:: RP01024
Additional Names:: ANG-5, ANGPT5, ANL3, FHBL2,ANGPTL3,ANGPT5,ANL3,FHBL2
Extra Details:: Recombinant Human Angiopoietin-like 3/ANGPTL3(17-220) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser17-Pro220) of human ANGPTL3/Angiopoietin-like 3 (Accession #NP_055310.1) fused with a 6xHis tag at the C-terminus.
Formulation:: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Immunogen:: Ser17-Pro220
Molecular Weight:: 24.64 kDa
Physical State:: Lyophilized
Purity:: ≥90%
Sequence:: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket