Recombinant Human Ephrin-A3/EFNA3 Protein
Product Sizes
10 ug
£107.00
RP01022-10UG
20 ug
£133.00
RP01022-20UG
50 ug
£163.00
RP01022-50UG
100 ug
£240.00
RP01022-100UG
About this Product
- SKU:
- RP01022
- Additional Names:
- EFNA3,EFL2,EPLG3,Ehk1-L,LERK3,ephrin-A3
- Extra Details:
- Recombinant Human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin A3 (Accession #NP_004943.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ser213
- Molecular Weight:
- 50.45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01022
