Recombinant Human IGF-I Protein
Product Sizes
50 ug
£145.00
RP00996-50UG
100 ug
£205.00
RP00996-100UG
About this Product
- SKU:
- RP00996
- Additional Names:
- IGF1,IGF-I,IGFI,MGF, IGFI, MGF
- Extra Details:
- Recombinant Human IGF-I Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence ( Gly 49 - Ala 118) of human IGF1 (Accession #NP_001104755.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly49-Ala118
- Molecular Weight:
- 34.44 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00996
