Recombinant Human CEACAM6/CD66c Protein
Product Sizes
10 ug
£133.00
RP00982-10UG
20 ug
£181.00
RP00982-20UG
50 ug
£240.00
RP00982-50UG
500 ug
£1002.00
RP00982-500UG
1000 ug
£1574.00
RP00982-1000UG
About this Product
- SKU:
- RP00982
- Additional Names:
- CEACAM6, NCA,Cell adhesion molecule CEACAM6, Carcinoembryonic antigen-related cell adhesion molecule 6, CEA cell adhesion molecule 6, Non-specific crossreacting antigen, Normal cross-reacting antigen, CD66c
- Extra Details:
- Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of human CEACAM6 (Accession #NP_002474.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of human CEACAM6 (Accession #NP_002474.3) fused with
- Immunogen:
- Lys35-Gly320
- Molecular Weight:
- 40-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00982


