Recombinant Human IL-7RA/CD127 Protein
Product Sizes
10 ug
£133.00
RP00976-10UG
20 ug
£181.00
RP00976-20UG
50 ug
£240.00
RP00976-50UG
100 ug
£353.00
RP00976-100UG
About this Product
- SKU:
- RP00976
- Additional Names:
- CD127, CDW127, IL-7R-alpha, IL7RA, ILRA,IL7R,CDW127,IL-7R-alpha,IL7RA,ILRA
- Extra Details:
- Recombinant Human IL-7RA/CD127 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu21-Gly236) of human IL7R alpha (Accession #NP_002176.2) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Glu21-Gly236
- Molecular Weight:
- 51.67 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00976
