Recombinant Human IL-7RA/CD127 Protein
Product Sizes
10 ug
£133.00
RP00976-10UG
20 ug
£181.00
RP00976-20UG
50 ug
£240.00
RP00976-50UG
100 ug
£353.00
RP00976-100UG
500 ug
£1002.00
RP00976-500UG
1000 ug
£1574.00
RP00976-1000UG
About this Product
- SKU:
- RP00976
- Additional Names:
- CD127, CDW127, IL-7R-alpha, IL7RA, ILRA,IL7R,CDW127,IL-7R-alpha,IL7RA,ILRA
- Extra Details:
- This protein also known as CD127, is a 75 kDa hematopoietin receptor superfamily member that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7 receptor alpha (CD127) signaling is essential for T-cell development and regulation of naive and memory T-cell homeostasis. IL-7RA is critically required for the proper development and function of lymphoid cells. Studies from both pathogenic and controlled HIV infection indicate that the containment of immune activation and preservation of CD127 expression are critical to the stability of CD4(+) T cells in infection. Factors relevant to HIV infection that could potentially decrease CD127 expression on human CD8(+) T cells. CD127 down-regulation may be an important contributor to HIV-associated T-cell dysfunction. In addition to IL-7, IL-7RA also associates with TSLPR to form the functional receptor for thymic stromal lymphopoietin (TSLP) which indirectly regulates T cell development by modulating dendritic cell activation. Mutations in the human IL-7RA gene cause a type of severe combined immunodeficiency in which the major deficiencies are in T cell development, whereas B and NK cells are relatively normal in number. Variation in the IL7RA gene was recently found associated with multiple sclerosis (MS). Soluble CD127 (sCD127) appears to play an important role in the immunopathogenesis of several chronic infections, multiple sclerosis, and various cancers.
- Formulation:
- Recombinant Human IL-7RA/CD127 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu21-Gly236) of human IL7R alpha (Accession #NP_002176.2) fused with an
- Immunogen:
- Glu21-Gly236
- Molecular Weight:
- 70-90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00976


