Recombinant Human CD47 Protein
Product Sizes
10 ug
£133.00
RP00974-10UG
20 ug
£181.00
RP00974-20UG
50 ug
£240.00
RP00974-50UG
100 ug
£353.00
RP00974-100UG
500 ug
£1002.00
RP00974-500UG
1000 ug
£1574.00
RP00974-1000UG
About this Product
- SKU:
- RP00974
- Additional Names:
- CD47, IAP, MER6, OA3, CD47 molecule,IAP,MER6,OA3
- Extra Details:
- This protein is a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
- Formulation:
- Recombinant Human CD47 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln19-Pro139) of human CD47 (Accession #NP_001768.1) fused with an Fc, 6xHis tag
- Immunogen:
- Gln19-Pro139
- Molecular Weight:
- 60-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00974


