Recombinant Human Insulin-like 3/INSL3 Protein
Product Sizes
10 ug
£145.00
RP00915-10UG
50 ug
£336.00
RP00915-50UG
About this Product
- SKU:
- RP00915
- Additional Names:
- INSL3,RLF,RLNL,ley-I-L
- Extra Details:
- Recombinant Human Insulin-like 3/INSL3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu21-Tyr131) of human INSL3/Insulin-like 3 (Accession #P51460) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu21-Tyr131
- Molecular Weight:
- 13.4 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00915
