Recombinant Human Amphiregulin/AREG Protein
Product Sizes
10 ug
£145.00
RP00898-10UG
50 ug
£336.00
RP00898-50UG
500 ug
£2050.00
RP00898-500UG
1000 ug
£2430.00
RP00898-1000UG
About this Product
- SKU:
- RP00898
- Additional Names:
- AREG,AR,AREGB,CRDGF,SDGF,amphiregulin
- Extra Details:
- Recombinant Human Amphiregulin/AREG Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser101-Lys198) of Human Amphiregulin/AREG (Accession #P15514) fused with an initial Met at the N-terminus.
- Formulation:
- Recombinant Human Amphiregulin/AREG Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser101-Lys198) of Human Amphiregulin/AREG (Accession #P15514) fused
- Immunogen:
- Ser101-Lys198
- Molecular Weight:
- 16 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00898




