Recombinant Human Jagged1/JAG1/CD339 Protein
Product Sizes
10 ug
£133.00
RP00877-10UG
20 ug
£181.00
RP00877-20UG
50 ug
£240.00
RP00877-50UG
100 ug
£353.00
RP00877-100UG
About this Product
- SKU:
- RP00877
- Additional Names:
- JAG1,AGS,AGS1,AHD,AWS,CD339,HJ1,JAGL1,jagged 1
- Extra Details:
- Recombinant Human Jagged1/JAG1/CD339 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Trp896-Arg1065) of human Jagged-1/JAG1 (Accession #P78504) fused with an Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Trp896-Arg1065
- Molecular Weight:
- 44.74 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- WCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00877




