Recombinant Human IL-17F Protein
Product Sizes
10 ug
£145.00
RP00870-10UG
20 ug
£193.00
RP00870-20UG
50 ug
£288.00
RP00870-50UG
100 ug
£431.00
RP00870-100UG
About this Product
- SKU:
- RP00870
- Additional Names:
- IL17F,CANDF6,IL-17F,ML-1,ML1
- Extra Details:
- Recombinant Human IL-17F Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg31-Gln163) of human IL-17F (Accession #Q96PD4) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Arg31-Gln163
- Molecular Weight:
- 15.76 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00870
