Recombinant Human Mature GDNF Protein
Product Sizes
10 ug
£193.00
RP00835-10UG
20 ug
£258.00
RP00835-20UG
50 ug
£383.00
RP00835-50UG
100 ug
£586.00
RP00835-100UG
About this Product
- SKU:
- RP00835
- Additional Names:
- GDNF, Glial cell line-derived neurotrophic factor, hGDNF, Astrocyte-derived trophic factor, ATF
- Extra Details:
- Recombinant Human GDNF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser78-Ile211) of human GDNF (Accession #P39905).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser78-Ile211
- Molecular Weight:
- 15.07 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00835
