Recombinant Human LR3-IGF-1(E51R) Protein
Product Sizes
50 ug
£115.00
RP00825-50UG
100 ug
£145.00
RP00825-100UG
About this Product
- SKU:
- RP00825
- Additional Names:
- IGF1, IBP1, IGF-1,Insulin-like growth factor 1, Insulin-like growth factor I, IGF-I, Mechano growth factor, MGF, Somatomedin-C
- Extra Details:
- Recombinant Human LR3-IGF-1(E51R) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly49-Ala118) of human IGF-1 (Accession #P05019) with the substitution of an Arg for Glu at position three and the addition of a thirteen aa N-terminal extension.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- MFPAMPLSSLFVNGly49-Ala118 (Glu51Arg)
- Molecular Weight:
- 9.12 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00825
