Recombinant Human TMIGD2/CD28H Protein
Product Sizes
10 ug
£193.00
RP00809-10UG
50 ug
£478.00
RP00809-50UG
About this Product
- SKU:
- RP00809
- Additional Names:
- Transmembrane and immunoglobulin domain-containing protein 2, Immunoglobulin and proline-rich receptor 1, IGPR1, TMIGD2
- Extra Details:
- Recombinant Human TMIGD2/CD28H Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu23-Gly150) of human TMIGD2/IGPR1 (Accession #Q96BF3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu23-Gly150
- Molecular Weight:
- 15.05 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00809
