Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein
Product Sizes
10 ug
£145.00
RP00805-10UG
50 ug
£336.00
RP00805-50UG
About this Product
- SKU:
- RP00805
- Additional Names:
- TNFRSF10C,CD263,DCR1,DCR1-TNFR,LIT,TRAIL-R3,TRAILR3,TRID
- Extra Details:
- Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala26-Ala221) of human TNFRSF10C/DcR1/TRAIL-R3/CD263 (Accession #O14798) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.Contact us for customized product form or formulation.
- Immunogen:
- Ala26-Ala221
- Molecular Weight:
- 21.78 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00805
