Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein
Product Sizes
10 ug
£145.00
RP00805-10UG
50 ug
£336.00
RP00805-50UG
500 ug
£1478.00
RP00805-500UG
1000 ug
£2430.00
RP00805-1000UG
About this Product
- SKU:
- RP00805
- Additional Names:
- TNFRSF10C,CD263,DCR1,DCR1-TNFR,LIT,TRAIL-R3,TRAILR3,TRID
- Extra Details:
- Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membraneprotein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks theintracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn ' t transduce an apoptosis signal. Theexpression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-inducedapoptosis.
- Formulation:
- Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala26-Ala221) of human TNFRSF10C/DcR1/TRAIL-R3/CD26
- Immunogen:
- Ala26-Ala221
- Molecular Weight:
- 38-58 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00805




