Recombinant Mouse Pleiotrophin/PTN Protein
Product Sizes
10 ug
£133.00
RP00791-10UG
50 ug
£288.00
RP00791-50UG
500 ug
£1240.00
RP00791-500UG
1000 ug
£1954.00
RP00791-1000UG
About this Product
- SKU:
- RP00791
- Additional Names:
- HBBM|HBGF-8|Heparin-binding brain mitogen|Heparin-binding growth factor 8|OSF-1|Osteoblast-specific factor 1|Pleiotrophin|PTN
- Extra Details:
- Pleiotrophin (PTN) is a secreted, strongly heparinbinding, developmentally regulated cytokine. PTN is a highlyconserved protein , Human, mouse, rat, canine, porcine, equine and bovine PTN share 98% aa sequenceidentity or greater. PTN and midkine share 50% amino acid (aa) sequence identity, share some functions, andconstitute a family. During development, PTN is involved in development of brain, bone, and organsundergoing branching morphogenesis. PTN causes PTPRB dimerization and inactivates its phosphatase activity,which allows increased tyrosine phosphorylation of its substrates. Increased expression of PTN is correlatedwith neuronal development or stresses such as brain ischemia and Parkinson's disease.
- Formulation:
- Recombinant Mouse Pleiotrophin/PTN Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Asp168) of mouse Pleiotrophin/PTN (Accession #P63089) fuse
- Immunogen:
- Gly33-Asp168
- Molecular Weight:
- 18-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00791
