Recombinant Mouse Pleiotrophin/PTN Protein
Product Sizes
10 ug
£133.00
RP00791-10UG
50 ug
£288.00
RP00791-50UG
About this Product
- SKU:
- RP00791
- Additional Names:
- HBBM|HBGF-8|Heparin-binding brain mitogen|Heparin-binding growth factor 8|OSF-1|Osteoblast-specific factor 1|Pleiotrophin|PTN
- Extra Details:
- Recombinant Mouse Pleiotrophin/PTN Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Asp168) of mouse Pleiotrophin/PTN (Accession #P63089) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly33-Asp168
- Molecular Weight:
- 16.1 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00791
