Recombinant Human RAMP3(M33L) Protein
Product Sizes
10 ug
£163.00
RP00782LQ-10UG
20 ug
£223.00
RP00782LQ-20UG
50 ug
£336.00
RP00782LQ-50UG
100 ug
£508.00
RP00782LQ-100UG
1000 ug
£2931.00
RP00782LQ-1000UG
About this Product
- SKU:
- RP00782LQ
- Additional Names:
- RAMP3,Receptor activity-modifying protein 3,RAMP3-H
- Extra Details:
- RAMP3 belongs to the RAMP family. Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1) .Required for the transport of CALCRL and GPER1 receptors to the plasma membrane .Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner.Together with CALCRL, form a receptor complex for adrenomedullin/ADM and intermedin/ADM2 .Together with CALCR, act as a receptor complex for amylin/IAPP.
- Formulation:
- Recombinant Human RAMP3(M33L) Protein is produced by CHO Cells system. The target protein is expressed with sequence (Arg24-Val118) of Human RAMP3 (Accession #NP_005847.1) fused with His tag at the C-
- Immunogen:
- Arg24-Val118
- Molecular Weight:
- 25-35 kDa
- Purity:
- ≥95%
- Sequence:
- RAGGCNETGLLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00782LQ
