Recombinant Mouse CCL8/MCP-2 Protein
Product Sizes
10 ug
£145.00
RP00773-10UG
20 ug
£193.00
RP00773-20UG
50 ug
£288.00
RP00773-50UG
100 ug
£431.00
RP00773-100UG
About this Product
- SKU:
- RP00773
- Additional Names:
- C-C motif chemokine 8|Ccl8|MCP-2|Mcp2|Monocyte chemoattractant protein 2|Monocyte chemotactic protein2|Scya8|Small-inducible cytokine A8
- Extra Details:
- Recombinant Mouse CCL8/MCP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gly24-Pro97) of mouse CCL8/MCP-2 (Accession #Q9Z121) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly24-Pro97
- Molecular Weight:
- 9.35 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00773




