Recombinant Mouse IL-27/IL-27A&IL-27B Protein
Product Sizes
10 ug
£163.00
RP00772-10UG
20 ug
£223.00
RP00772-20UG
About this Product
- SKU:
- RP00772
- Additional Names:
- Interleukin-27 subunit alpha,IL27-A,p28,Il27,Il27a,Interleukin-27 subunit beta,Ebi3,IL-27 subunitbeta,IL-27B,Il27b
- Extra Details:
- Recombinant Mouse IL-27 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr19-Pro228&Phe29-Ser234) of mouse IL-27 (Accession #O35228&Q8K3I6) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Tyr19-Pro228&Phe29-Ser234
- Molecular Weight:
- 48.80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00772
