Recombinant Mouse TNFSF9/4-1BB Ligand Protein
Product Sizes
10 ug
£145.00
RP00766-10UG
20 ug
£193.00
RP00766-20UG
50 ug
£288.00
RP00766-50UG
100 ug
£431.00
RP00766-100UG
About this Product
- SKU:
- RP00766
- Additional Names:
- Tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, 4-1BBL, Tnfsf9, Cd137l,Cd157l, Ly63l, TNFSF9
- Extra Details:
- Recombinant Mouse TNFSF9/4-1BB Ligand Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg104-Glu309) of mouse TNFSF9/4-1BB Ligand (Accession #P41274) fused with aHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Arg104-Glu309
- Molecular Weight:
- 23.80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00766




