Recombinant Mouse IFN-alpha 6 Protein
Product Sizes
10 ug
£133.00
RP00765-10UG
20 ug
£181.00
RP00765-20UG
50 ug
£240.00
RP00765-50UG
100 ug
£353.00
RP00765-100UG
500 ug
£1002.00
RP00765-500UG
1000 ug
£1574.00
RP00765-1000UG
About this Product
- SKU:
- RP00765
- Additional Names:
- Ifna6, If1ai11, Interferon 1ai11, Interferon alpha 6
- Extra Details:
- Mature mouse IFNA6 consists of 166 aa and shares 60% aa identity with human IFNA6. The type I IFNs binds to the interferon alpha receptor (IFNAR) which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit) . Individual IFN alpha subtypes are known to display unique efficacies to viral protection, with IFNA6 displaying the superior efficacy controlling influenza virus infection and disease . Treatment with IFNA6 DNA 2 weeks post-MCMV infection proved effective at inhibiting the development of chronic autoimmune myocarditis. IFNA6 is also able to reduce chronic cardiac inflammation. These findings suggest that immunomodulation of both antiviral and autoimmune responses by IFN DNA immunization may be an avenue for improved viral immunotherapy .
- Formulation:
- Recombinant Mouse IFN-alpha 6 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 6(Accession #NP_996754.1) fused with His tag a
- Immunogen:
- Cys24-Glu189
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPQTHNLRNKKALTLLVQMRRLSPLSCLKDRKDFGFPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLKACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAKLLARLSEDE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00765




