Recombinant Mouse IFN-alpha 6 Protein
Product Sizes
10 ug
£133.00
RP00765-10UG
20 ug
£181.00
RP00765-20UG
50 ug
£240.00
RP00765-50UG
100 ug
£353.00
RP00765-100UG
About this Product
- SKU:
- RP00765
- Additional Names:
- Ifna6, If1ai11, Interferon 1ai11, Interferon alpha 6
- Extra Details:
- Recombinant Mouse IFN-alpha 6 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 6(Accession #NP_996754.1) fused with His tag at the C-Terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Cys24-Glu189
- Molecular Weight:
- 19.75 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPQTHNLRNKKALTLLVQMRRLSPLSCLKDRKDFGFPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLKACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAKLLARLSEDE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00765
