Recombinant Mouse CD47 Protein
Product Sizes
10 ug
£145.00
RP00762-10UG
20 ug
£193.00
RP00762-20UG
50 ug
£288.00
RP00762-50UG
100 ug
£395.00
RP00762-100UG
About this Product
- SKU:
- RP00762
- Additional Names:
- Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-AssociatedProtein, IAP, Protein MER6, CD47, MER6
- Extra Details:
- Recombinant Mouse CD47/IAP/OA3 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln19-Lys140
- Molecular Weight:
- 14.68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00762
