Recombinant Mouse Fc-gamma RIII/CD16 Protein
Product Sizes
10 ug
£145.00
RP00761-10UG
50 ug
£336.00
RP00761-50UG
About this Product
- SKU:
- RP00761
- Additional Names:
- CD-antigen 16|CD16|Fc gamma Receptor III|Fcgr3|FcRIII|IgG Fc receptor III|Low affinity immunoglobulin gamma Fc region receptor III
- Extra Details:
- Recombinant Mouse Fc-gamma RIII/CD16 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala31-Thr215) of mouse Fc G Gamma RIIIA/FCGR3/CD16 (Accession #P08508) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala31-Thr215
- Molecular Weight:
- 22 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00761
