Recombinant Mouse IFN-alpha 5 Protein
Product Sizes
10 ug
£133.00
RP00759-10UG
20 ug
£181.00
RP00759-20UG
50 ug
£240.00
RP00759-50UG
100 ug
£353.00
RP00759-100UG
500 ug
£1002.00
RP00759-500UG
1000 ug
£1574.00
RP00759-1000UG
About this Product
- SKU:
- RP00759
- Additional Names:
- Ifna5, If1ai12, Interferon 1ai12, Interferon alpha 5
- Extra Details:
- IFN-alpha 5 belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
- Formulation:
- Recombinant Mouse IFN-alpha 5 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 5(Accession #NP_034635.2) fused with His tag a
- Immunogen:
- Cys24-Glu189
- Molecular Weight:
- 20-25 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00759
