Recombinant Mouse IFN-alpha 4 Protein
Product Sizes
10 ug
£133.00
RP00756-10UG
20 ug
£181.00
RP00756-20UG
50 ug
£240.00
RP00756-50UG
100 ug
£353.00
RP00756-100UG
500 ug
£1002.00
RP00756-500UG
1000 ug
£1574.00
RP00756-1000UG
About this Product
- SKU:
- RP00756
- Additional Names:
- Ifna4, Interferon alpha-4, IFN-alpha-4
- Extra Details:
- The interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, and are classified based on their binding specificity to cell surface receptors . The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 ( alpha -subunit) and IFNAR2 ( beta -subunit). This binding contributes to TNF-alpha induced signaling .
- Formulation:
- Recombinant Mouse IFN-alpha 4 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Leu23-Glu186) ofMouse IFN-alpha 4(Accession #NP_034634.1) fused with His tag at
- Immunogen:
- Leu23-Glu186
- Molecular Weight:
- 20-30 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00756
