Recombinant Human HB-EGF Protein
Product Sizes
10 ug
£127.00
RP00754-10UG
20 ug
£157.00
RP00754-20UG
50 ug
£223.00
RP00754-50UG
100 ug
£336.00
RP00754-100UG
500 ug
£937.00
RP00754-500UG
1000 ug
£1478.00
RP00754-1000UG
About this Product
- SKU:
- RP00754
- Additional Names:
- DTR, DTS, DTSF, HEGFL,HBEGF,DTS,DTSF,HEGFL|HB-EGF
- Extra Details:
- Heparin-binding EGF-like growth factor (HB-EGF) is a 12-16 kDa member of the epidermal growth factor (EGF)family. It possesses an EGF-like domain, and a heparin-binding motif. Mature HB-EGF is a soluble peptide thatarises from proteolytic processing of the transmembrane form. Human HB -EGF shows 76% and 73% aasequence identity with rat and mouse HB-EGF, respectively. It is required for normal cardiac valve formationand normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB-EGF classified as agroup 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activityassociated with ErbB4 binding appears to be limited to non -mitogenic actions, while EGFR binding inducesboth mitogenic and non-mitogenic activity.
- Formulation:
- Recombinant Human HB-EGF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Leu20-Leu148) of human HB-EGF (Accession #Q99075) fused with a 6xHis tag a
- Immunogen:
- Leu20-Leu148
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00754
