Recombinant Mouse TNFRSF6/FAS/CD95 Protein
Product Sizes
10 ug
£145.00
RP00737-10UG
50 ug
£336.00
RP00737-50UG
About this Product
- SKU:
- RP00737
- Additional Names:
- Apo-1 antigen|Apoptosis-mediatingsurface antigen FAS|CD95|Fas|FASLG receptor|TNFRSF6|Tumor necrosis factor receptor superfamily member 6
- Extra Details:
- Recombinant Mouse TNFRSF6/FAS/CD95 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln22-Arg169) of Mouse TNFRSF6/FAS/CD95 (Accession #P25446 ) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln22-Arg169
- Molecular Weight:
- 17.4 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00737
