Recombinant Mouse TNFRSF6/FAS/CD95 Protein
Product Sizes
10 ug
£145.00
RP00737-10UG
50 ug
£336.00
RP00737-50UG
500 ug
£2050.00
RP00737-500UG
1000 ug
£2430.00
RP00737-1000UG
About this Product
- SKU:
- RP00737
- Additional Names:
- Apo-1 antigen|Apoptosis-mediatingsurface antigen FAS|CD95|Fas|FASLG receptor|TNFRSF6|Tumor necrosis factor receptor superfamily member 6
- Extra Details:
- Mouse Apoptosis-mediating surface antigen FAS (Fas) belongs to the death receptor subfamily of the TNFreceptor superfamily and is designated TNFRSF6. Mouse Fas contains 1 death domain and 3 TNFR-Cys repeats.It detected in various tissues including thymus, liver, lung, heart, and adult ovary. As a receptor forTNFSF6/FASLG, The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequentcascade of caspases mediating apoptosis. FAS-mediated apoptosis may have a role in the induction ofperipheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
- Formulation:
- Recombinant Mouse TNFRSF6/FAS/CD95 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln22-Arg169) of Mouse TNFRSF6/FAS/CD95 (Accession #P25446 ) fus
- Immunogen:
- Gln22-Arg169
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00737
