Recombinant Human Mature BMP-9/GDF-2 Protein
Product Sizes
20 ug
£318.00
RP00722-20UG
50 ug
£478.00
RP00722-50UG
100 ug
£734.00
RP00722-100UG
About this Product
- SKU:
- RP00722
- Additional Names:
- GDF2, BMP9,Growth/differentiation factor 2, GDF-2, Bone morphogenetic protein 9, BMP-9
- Extra Details:
- Recombinant Human Mature BMP-9/GDF-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser320-Arg429) of Human Mature BMP-9/GDF-2 (Accession # Q9UK05) fused with no tag.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Ser320-Arg429
- Molecular Weight:
- 12.09 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00722
