Recombinant Human Mature BMP-9/GDF-2 Protein
Product Sizes
10 ug
£223.00
RP00722-10UG
20 ug
£318.00
RP00722-20UG
50 ug
£478.00
RP00722-50UG
100 ug
£734.00
RP00722-100UG
500 ug
£2192.00
RP00722-500UG
1000 ug
£3478.00
RP00722-1000UG
About this Product
- SKU:
- RP00722
- Additional Names:
- GDF2, BMP9,Growth/differentiation factor 2, GDF-2, Bone morphogenetic protein 9, BMP-9
- Extra Details:
- BMP-9 is a member of the BMP subgroup of the TGF-beta superfamily proteins that signal through heterodimeric complexes composed of type I and type II BMP receptors. GDF-2 Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. ALK1 is a signalling receptor for bone morphogenetic protein-9 (BMP-9) in endothelial cells (ECs). BMP-9 bound with high affinity to ALK1 and endoglin, and weakly to the type-I receptor ALK2 and to the BMP type-II receptor (BMPR-II) and activin type-II receptor (ActR-II) in transfected COS cells.
- Formulation:
- Recombinant Human Mature BMP-9/GDF-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser320-Arg429) of Human Mature BMP-9/GDF-2 (Accession # Q9UK0
- Immunogen:
- Ser320-Arg429
- Molecular Weight:
- 10-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00722
