Recombinant Mouse CCL3/MIP-1 alpha Protein
Product Sizes
10 ug
£145.00
RP00714-10UG
20 ug
£193.00
RP00714-20UG
50 ug
£288.00
RP00714-50UG
About this Product
- SKU:
- RP00714
- Additional Names:
- Ccl3, Mip1a, Scya3, C-C motif chemokine 3,MIP-1-alpha, SIS-alpha
- Extra Details:
- Recombinant Mouse CCL3/MIP-1 alpha Protein is produced by CHO cells expression system. The target protein is expressed with sequence (Ala24-Ala92) of Mouse CCL3/MIP-1 alpha (Accession # NP_035467.1) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in 50mM Acetate-sodium acetate pH3.6 .
- Immunogen:
- Ala24-Ala92
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00714
