Recombinant Mouse CCL3/MIP-1 alpha Protein
Product Sizes
10 ug
£145.00
RP00714-10UG
20 ug
£193.00
RP00714-20UG
50 ug
£288.00
RP00714-50UG
500 ug
£1240.00
RP00714-500UG
1000 ug
£1954.00
RP00714-1000UG
About this Product
- SKU:
- RP00714
- Additional Names:
- Ccl3, Mip1a, Scya3, C-C motif chemokine 3,MIP-1-alpha, SIS-alpha
- Extra Details:
- Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)
- Formulation:
- Recombinant Mouse CCL3/MIP-1 alpha Protein is produced by CHO cells expression system. The target protein is expressed with sequence (Ala24-Ala92) of Mouse CCL3/MIP-1 alpha (Accession # NP_035467.1) f
- Immunogen:
- Ala24-Ala92
- Molecular Weight:
- 10.8 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00714




