Recombinant Mouse TNFSF4/OX40 ligand/CD252 Protein
Product Sizes
10 ug
£145.00
RP00713-10UG
50 ug
£336.00
RP00713-50UG
500 ug
£2050.00
RP00713-500UG
1000 ug
£2430.00
RP00713-1000UG
About this Product
- SKU:
- RP00713
- Additional Names:
- Tumor necrosis factor ligand superfamily member 4, TNFSF4, CD134 ligand, CD134L, CD252,CD252 antigen, OX40 antigen ligand, OX40 ligand, OX40L, TAX transcriptionally-activatedglycoprotein 1, tumor necrosis factor (ligand) superfamily, member 4, Tnfsf4
- Extra Details:
- OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptorsuperfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival andfor the generation of memory T cells from activated effector T cells. OX40L - OX40 co-stimulation leads toactivation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong thesurvival of effector CD4+Th cells as well as contributes to generation of memory T cells.
- Formulation:
- Recombinant Mouse TNFSF4/OX40 Ligand Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser51-Leu198) of mouse TNFSF4/OX40 Ligand (Accession #P43488)
- Immunogen:
- Ser51-Leu198
- Molecular Weight:
- 20-23 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00713
