Recombinant Mouse TNFSF4/OX40 ligand/CD252 Protein
Product Sizes
10 ug
£145.00
RP00713-10UG
50 ug
£336.00
RP00713-50UG
About this Product
- SKU:
- RP00713
- Additional Names:
- Tumor necrosis factor ligand superfamily member 4, TNFSF4, CD134 ligand, CD134L, CD252,CD252 antigen, OX40 antigen ligand, OX40 ligand, OX40L, TAX transcriptionally-activatedglycoprotein 1, tumor necrosis factor (ligand) superfamily, member 4, Tnfsf4
- Extra Details:
- Recombinant Mouse TNFSF4/OX40 Ligand Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser51-Leu198) of mouse TNFSF4/OX40 Ligand (Accession #P43488) fused with an 8xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser51-Leu198
- Molecular Weight:
- 17.7 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00713
