Recombinant Mouse CD47 Protein
Product Sizes
10 ug
£133.00
RP00711-10UG
20 ug
£181.00
RP00711-20UG
50 ug
£240.00
RP00711-50UG
100 ug
£353.00
RP00711-100UG
500 ug
£1002.00
RP00711-500UG
1000 ug
£1574.00
RP00711-1000UG
About this Product
- SKU:
- RP00711
- Additional Names:
- Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-AssociatedProtein, IAP, Protein MER6, CD47, MER6
- Extra Details:
- CD47, also known as Integrin-Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig-like domain, five membrane-spanning regions with short intervening loops, andC-terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.
- Formulation:
- Recombinant Mouse CD47 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with an Fc t
- Immunogen:
- Gln19-Lys140
- Molecular Weight:
- 60-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00711
