Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein
Product Sizes
10 ug
£145.00
RP00703-10UG
20 ug
£193.00
RP00703-20UG
50 ug
£288.00
RP00703-50UG
100 ug
£431.00
RP00703-100UG
About this Product
- SKU:
- RP00703
- Additional Names:
- NPPB,BNP
- Extra Details:
- Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Pro104) of human Brain Natriuretic Peptide/BNP (Accession #P16860) fused with a hFC tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- His27-Pro104
- Molecular Weight:
- 34.60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP00703
