Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein
Product Sizes
10 ug
£145.00
RP00703-10UG
20 ug
£193.00
RP00703-20UG
50 ug
£288.00
RP00703-50UG
100 ug
£431.00
RP00703-100UG
500 ug
£1240.00
RP00703-500UG
1000 ug
£1954.00
RP00703-1000UG
About this Product
- SKU:
- RP00703
- Additional Names:
- NPPB,BNP
- Extra Details:
- Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly byventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNPprecursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriureticpeptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from theventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF)and atrial septal defect in patients without HF.
- Formulation:
- Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Pro104) of human Brain Natriur
- Immunogen:
- His27-Pro104
- Molecular Weight:
- 35-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP00703
