Recombinant Human S100-B Protein
Product Sizes
10 ug
£127.00
RP00699-10UG
20 ug
£175.00
RP00699-20UG
50 ug
£240.00
RP00699-50UG
100 ug
£336.00
RP00699-100UG
500 ug
£1002.00
RP00699-500UG
1000 ug
£1574.00
RP00699-1000UG
About this Product
- SKU:
- RP00699
- Additional Names:
- NEF,S100,S100-B,S100beta,S100B,S100 beta
- Extra Details:
- S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B containstwo EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B playsan important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotectiveeffects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increasesfollowing brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into theblood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytesare the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominantS100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations inserum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before grosschanges develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. Inaddition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancyboth in bioptic tissue and in serum.
- Formulation:
- Recombinant Human S100-B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100 Calcium Binding Protein B/S100B (Accession #P04
- Immunogen:
- Ser2-Glu92
- Molecular Weight:
- 40-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00699
