Recombinant Human S100-B Protein
Product Sizes
10 ug
£127.00
RP00699-10UG
20 ug
£175.00
RP00699-20UG
50 ug
£240.00
RP00699-50UG
100 ug
£336.00
RP00699-100UG
About this Product
- SKU:
- RP00699
- Additional Names:
- NEF,S100,S100-B,S100beta,S100B,S100 beta
- Extra Details:
- Recombinant Human S100-B Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100 Calcium Binding Protein B/S100B (Accession #P04271) fused with an initial Met at the N-terminus and a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PBS,150mM NaCl,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser2-Glu92
- Molecular Weight:
- 38.35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00699
