Recombinant Human Alkaline phosphatase (Intestinal type)/ALPI Protein
Product Sizes
20 ug
£193.00
RP00679-20UG
50 ug
£264.00
RP00679-50UG
100 ug
£395.00
RP00679-100UG
500 ug
£1157.00
RP00679-500UG
1000 ug
£1812.00
RP00679-1000UG
About this Product
- SKU:
- RP00679
- Additional Names:
- ALPI, Intestinal-type alkaline phosphatase, IAP, Intestinal alkaline phosphatase, EC:3.1.3.1
- Extra Details:
- Recombinant Human Alkaline phosphatase (Intestinal type)/ALPI Protein encodes for intestinal phosphatase alkaline, a brush border metalloenzyme that hydrolyses phosphate from the lipid A moiety of lipopolysaccharides and thereby drastically reduces Toll-like receptor 4 agonist activity. ALPI mutations impaired either stability or catalytic activity of ALPI and rendered it unable to detoxify lipopolysaccharide-dependent signalling. ALPI mutations should be included in screening for monogenic causes of inflammatory bowel diseases and lay the groundwork for ALPI-based treatments in intestinal inflammatory disorders.
- Formulation:
- Recombinant Human Alkaline phosphatase (Intestinal type)/ALPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val20-Thr502) of Human Alkaline phos
- Immunogen:
- Val20-Thr502
- Molecular Weight:
- 60-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00679
