Recombinant Mouse/Rat Mature TGF-beta 2 Protein
Product Sizes
10 ug
£193.00
RP00672-10UG
20 ug
£258.00
RP00672-20UG
50 ug
£383.00
RP00672-50UG
100 ug
£586.00
RP00672-100UG
500 ug
£1716.00
RP00672-500UG
1000 ug
£2716.00
RP00672-1000UG
About this Product
- SKU:
- RP00672
- Additional Names:
- BSC-1 cell growth inhibitor|Cetermin|G-TSF|Glioblastoma-derived T-cell suppressor factor|MGC116892|Polyergin|TGF-beta-2|TGF-beta2|TGFB2|transforming growth factor beta-2
- Extra Details:
- Transforming growth factor beta 2 (TGF- B Beta 2) is a member of TGF-beta superfamily that shares a characteristiccysteine knot structure. Mice with TGF- B Beta 2 gene deletion show defects in development of cardiac, lung,craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF-B Beta isoforms signal via the sameheteromeric receptor complex, consisting of a ligand binding TGF- B Beta receptor type II (T B Beta R-II), and a TGF- B Betareceptor type I (T B Beta R-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- B Betaexpression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney,gut, liver, eye, ear, skin, and the nervous system.
- Formulation:
- Recombinant Mouse TGF-beta 2/TGFB2 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala303-Ser414) of mouse TGF-beta 2/TGFB2 (Accession #P27090).
- Immunogen:
- Ala303-Ser414
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00672
