Recombinant Mouse/Rat Mature TGF-beta 2 Protein
Product Sizes
10 ug
£193.00
RP00672-10UG
20 ug
£258.00
RP00672-20UG
50 ug
£383.00
RP00672-50UG
100 ug
£586.00
RP00672-100UG
About this Product
- SKU:
- RP00672
- Additional Names:
- BSC-1 cell growth inhibitor|Cetermin|G-TSF|Glioblastoma-derived T-cell suppressor factor|MGC116892|Polyergin|TGF-beta-2|TGF-beta2|TGFB2|transforming growth factor beta-2
- Extra Details:
- Recombinant Mouse TGF-beta 2/TGFB2 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala303-Ser414) of mouse TGF-beta 2/TGFB2 (Accession #P27090).
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 4 mM HCl.Contact us for customized product form or formulation.
- Immunogen:
- Ala303-Ser414
- Molecular Weight:
- 12.69 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00672
