Recombinant Mouse/Rat Mature TGF-beta 1 Protein
Product Sizes
10 ug
£193.00
RP00671-10UG
20 ug
£258.00
RP00671-20UG
50 ug
£383.00
RP00671-50UG
100 ug
£586.00
RP00671-100UG
About this Product
- SKU:
- RP00671
- Additional Names:
- TGF-beta1,Tgfb,Tgfb-1,TGFbeta1,CED,DPD1,LAP,TGFB,TGFbeta,TGFB1
- Extra Details:
- Recombinant Mouse TGF-beta 1/TGFB1 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala279-Ser390) of mouse TGF-beta 1/TGFB1 (Accession #P04202).
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 50 mM Glycine,150 mM NaCl, pH3.5. Contact us for customized product form or formulation.
- Immunogen:
- Ala279-Ser390
- Molecular Weight:
- 12.81 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00671








