Recombinant Mouse Mature Beta-nerve growth factor/NGFB Protein
Product Sizes
10 ug
£127.00
RP00667-10UG
20 ug
£175.00
RP00667-20UG
About this Product
- SKU:
- RP00667
- Additional Names:
- Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB
- Extra Details:
- Recombinant Mouse Beta-nerve growth factor/NGFB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser122-Gly241) of Mouse Beta-nerve growth factor/NGFB (Accession #P01139) fused with no tag.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 50mM NaAc,150mM NaCl,pH5.5.
- Immunogen:
- Ser122-Gly241
- Molecular Weight:
- 12.4 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00667
