Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein
Product Sizes
10 ug
£193.00
RP00666-10UG
20 ug
£258.00
RP00666-20UG
50 ug
£383.00
RP00666-50UG
100 ug
£586.00
RP00666-100UG
About this Product
- SKU:
- RP00666
- Additional Names:
- IL-1ra, F630041P17Rik,IL1RN
- Extra Details:
- Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg27-Gln178) of mouse IL-1Ra/IL-1F3/IL-1RN (Accession #P25085) fused with an initial Met at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg27-Gln178
- Molecular Weight:
- 17.33 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00666








