Recombinant Mouse IL-21 Protein
Product Sizes
10 ug
£145.00
RP00664-10UG
20 ug
£193.00
RP00664-20UG
50 ug
£288.00
RP00664-50UG
100 ug
£431.00
RP00664-100UG
About this Product
- SKU:
- RP00664
- Additional Names:
- Il21,Interleukin-21, IL-21
- Extra Details:
- Recombinant Mouse IL-21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Ser146) of Mouse IL-21 (Accession #NP_068554.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- His18-Ser146
- Molecular Weight:
- 40.79 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00664
