Biotinylated Recombinant Human uPAR/PLAUR/CD87 Protein
Product Sizes
100 ug
£657.00
RP00653B-100UG
500 ug
£1954.00
RP00653B-500UG
1000 ug
£3382.00
RP00653B-1000UG
About this Product
- SKU:
- RP00653B
- Additional Names:
- CD87|MO3|PLAUR|U-PAR|uPAR
- Conjugate:
- Biotin
- Extra Details:
- The receptor (u-PAR) for urokinase plasminogen activator (u-PA) is a three-domain protein, GPI-anchored to the cell surface, which focuses the enzymatic activity of u-PA, and allows the cell surface activation of plasminogen.Regulation of the activity of u-PA is also mediated by u-PAR.
- Formulation:
- Biotinylated Recombinant Human uPAR/PLAUR/CD87 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Gly305) of Human uPAR/PLAUR/CD87 (Accession #
- Immunogen:
- Leu23-Gly305
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00653B
