Recombinant Human uPA/PLAU Protein
Product Sizes
100 ug
£431.00
RP00652-100UG
About this Product
- SKU:
- RP00652
- Additional Names:
- ATF|BDPLT5|PLAU|QPD|u-PA|UPA|URK|Urokinase
- Extra Details:
- Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Leu431) of Human uPA/PLAU (Accession #P00749-1) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in 1% HCOOH, 1 mM DTT (pH 3.0). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ser21-Leu431
- Molecular Weight:
- 17.9, 29.2, 15.3 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00652
