Recombinant Human PLAU/uPA Protein (pro form)

Product Sizes

25 ug

£193.00

RP00651-25UG

100 ug

£478.00

RP00651-100UG

About this Product

SKU:: RP00651
Additional Names:: ATF|BDPLT5|PLAU|QPD|u-PA|UPA|URK|Urokinase
Extra Details:: Plasminogen activator, urokinase (uPA) is a secreted serine protease whose Dysregulation is often accompanied by various cancers. PLAU inhibition could suppress tumor growth. Collectively, PLAU is necessary for tumor progression and can be a diagnostic and prognostic biomarker in HNSCC.
Formulation:: Recombinant Human PLAU/uPA Protein (pro form) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Leu431) of Human PLAU/uPA (pro form) (Accession #P0074
Immunogen:: Ser21-Leu431
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket