Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein
Product Sizes
10 ug
£145.00
RP00649-10UG
50 ug
£288.00
RP00649-50UG
About this Product
- SKU:
- RP00649
- Additional Names:
- Thymic stroma-derived lymphopoietin|Thymic stromal lymphopoietin|Tslp
- Extra Details:
- Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr20-Glu140) of mouse Thymic stromal lymphopoietin/TSLP (Accession #Q9JIE6) fused with an Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Tyr20-Glu140
- Molecular Weight:
- 42.3 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00649
