Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein
Product Sizes
10 ug
£145.00
RP00649-10UG
50 ug
£288.00
RP00649-50UG
500 ug
£1240.00
RP00649-500UG
1000 ug
£1954.00
RP00649-1000UG
About this Product
- SKU:
- RP00649
- Additional Names:
- Thymic stroma-derived lymphopoietin|Thymic stromal lymphopoietin|Tslp
- Extra Details:
- Thymic stromal lymphopoietin (TSLP) is a protein belonging to the cytokine family, contains 140 amino acids. Itis known to play an important role in the maturation of T cell populations through activation of antigenpresenting cells. TSLP induces the release of T-cell-attracting chemokines from monocytes and, in particular,enhances the maturation of CD11c+ dendritic cells. It can induce allergic inflammation by directly activatingmast cells. TSLP is produced mainly by non-hematopoietic cells such as fibroblasts, epithelial cells and differenttypes of stromal or stromal-like cells. These cells are located in regions where TSLP activity is required.
- Formulation:
- Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr20-Glu140) of mouse Thymic stromal lymphopoi
- Immunogen:
- Tyr20-Glu140
- Molecular Weight:
- 60 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00649
